GenomeNet

>api:100168185 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) Ance-like; angiotensin converting enzyme-like (A)
MTMKLYHLCVILCLLATVVWRPVLSAGIKNCSHCSEIEASKYLENANHALTQWTNRVIHA
NWNWLTNLTNENAEKKLAINLEFSKFLKCMWEETVKYPWTTYKNPNIKRQFKLMSVLGTD
ALPEDKLKKLEETIAAMESLYGRATIPEYGDNNSNRTLSLEPDINDILDKSTDVNELKHV
WVQWREATGKKVRPMYAEYVKLSNEAARLNNYTDTAEFWIRGYDVDDFRPRMERLWNQIK
PLYLQIHAYVRRKLRELYGDSMITKRGPIPAHLLGDMWAQSWERLDDFTRPYPTIDDVNP
TSAMINQNYTPKKMFKVAEEFFTSLNLSAMPQAFWEKSILEKPNGRDLVCHASAWDFYDS
NDFRIKQCTSVNFMDFITAHHEMGHVQYFLQYKDQPFIYREGANEGFHEAIGDTIALSVS
TPKHLHKIGLLPKTSRTYEADINYLYKIGLDKIAFLPFGYLMDLWRWNVFKGITTEDQYN
CDWWKLKYSYQGIEPPVTRTEKDFDPGSKYHIVGNVPYIRYFVSFIVQFQFHQALCEKAG
QFDPKNPSSQPLHECDIYQSTNAGNAFKDMLKLGSSKPWFDAMEQLTGQREMDAGPLLNY
FNPLYEWLKNENKRSGEYIGWETNKKICLKKGETSQP

BLAST