GenomeNet

>api:100169332 glutamate decarboxylase-like protein 1-like (A)
MPIVMPAATVPTDYATARPVELMVTASTLDETPCGKGPMMESLSAAVCGYKSAPNAADHE
AFVRDAVRLMLEQAVFRGTDRRRPVLNWKSPEELQAAFDFALDRSPTTHGHLLNLIEDTI
EHSVKTGHPYFINQLFSSVDPYGLIGQWLTDALNPSVYTFEVAPVMTIMEETVLTEMRKF
LGYPDGKGDGIFCPGGSIANGYAINCARFSAFPEVKTRGMHGLPRLVVYTSADAHYSIKK
LCAFEGIGSDNLYLINTDAKGKMDVSHLRQQIQRTLEEKAVPIMVSATAGTTVLGAFDPI
AEIADVCHEYGIWLHVDAAWGGGALVSKKHKHLLTGIDRADSVTWNPHKMLTAPQQCSTF
LTKHERVLTESNSSCAQYLFQKDKFYDTTYDTGDKHIQCGRRADVFKFWFMWKAKGTDGL
EAHVDENFDNAKYFTEMIRNRAGFKLVLEEPEYTNITFWYIPPSLRGRQNEPDFKNKLHK
VAPRIKERMMKEGTMMITYQPSDDLPNFFRLVLQNSSLDQNDMDYFVNEIERLGSDL

BLAST