GenomeNet

>apla:101791292 protein-glutamine gamma-glutamyltransferase E-like; K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MGQAATQPSTNWHLKENTRDHHTSKFSSKELIVRRGQAFVVTFSGIEQPEQNLTFIAETG
PKPSKQAKTQATFGISSTVSKENWSAVLQSTSSNSASIAISSPANAVIGRYKLSVQSTSS
GSSSPATLGTFVLLFNPWSSGDDVFMSNKAECEEYVLEEFGIIFSGNTHHINSFGWNFGQ
FQGDILNICLSMLDRSLNYRQDPATDVSHRNDPKYLGRVLSAMVNGNDDQGVVLGNWSGN
YEGGKSPSSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLERGADSVWNFHVWNESWFSRSDLGPSYSGWQILDATPQEE
SGGIYQCGPASRNAIKEGDVELDYDCPFVFAEVNADRMYWNYDPATGKKTLIFSKTTTIG
QFISTKAVGRDDRVDVTSDYKYEEGSRKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKP
DISGKFKVAGPLEVGKDLNLILVLANLQSDVKSVHVNMTAWSTVYTRRPVREIWKDSISV
TLSPGEEKHFPVKISYAEYQQQLTTDNTIQITALCHVEGGIQVLVQRDITLDNPAIDIQV
LGEAKVNKEVDVEVVFTNPINAEVMDCVLQVEGNDLLRGILEIDVPPLKAGEKSSTKFKL
TPVETGSKHLLVNFSCDKFSDIKAFKTVNVID

BLAST