GenomeNet

>apla:101792660 K05624 transglutaminase 6 [EC:2.3.2.13] | (RefSeq) TGM6; protein-glutamine gamma-glutamyltransferase 6 (A)
MPCIFLALKIANINWQSKLNKAAHHTSDYSSTEVILRRGQAFTISLNFQTTVQPWDNFTF
IASTGPSPAESQHTKVIFNLSDEGASGWSATQEHSEHGCMNFTIVSPANAVIGRYKLKLQ
TDSGNKFSSVLLGHFVLLFNPWCPNDDVYMANEKDRQEYVLNDSGIIFHGVEKYIQQEAW
NYGQFEEDILDISLAILDRSLNHRKDPSIDVSNRNNPIYVSRVISAMVNSNDEKGVVEGK
WNGKYRSGTNPLHWSGSVTILRKWYRRRYKPVRYGQCWVFAGVMCTVLRSLGIPTRVITN
FNSAHDRNINLSIDKYIDISGKTLHLTEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDAT
PQEVSKGIFQCGPASTKAIKEGDVNLDYDSSFVFAAVNADCVTWIHYSNKRKERIYSNTR
KIGKFISTKAVGTNSRVDVTDNYKYPEGSLKERQVYKKALKLLGVSSTGRRTKVTRRRRR
FSVARRQNMTVPTGKPTVSGKLNLDASPVIGQDILLTLSLRNLITDFKTIKVKLSASAVL
YTRKPKTEILQWSRSIQLGSEEVKEIPFKISYSQYKNALMDDRKILVTALCEVRQGNSLL
MEKDILLQDPFLTIKVFGPTVVHKAANVQVTFTNPLSETVTDCVLRAEGSGLLKEQLQIN
VAQMAPMEPSTIEFEIIPYKSGTRQLQVDLVSNHFSDIKGFVMLDVTLVQ

BLAST