GenomeNet

>apla:101798540 TK1; thymidine kinase 1, soluble; K00857 thymidine kinase [EC:2.7.1.21] (A)
CLLVKYAKDTRYGTAGLSTHDRNTMEALPACLLRDVYQEALGAAVIGIDEGQFFPDIVEF
CEMMANAGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYREASYTKRLGA
EREVEVIGGADKYHSVCXXRACYFQKRPQQLGSDNKENVPLGAKQLDVLCLPNQPAGPLL
QEPGSAGNPISSSLLSLPKI

BLAST