GenomeNet

>apn:Asphe3_04250 ATP-dependent DNA ligase LigD polymerase module;ATP-dependent DNA ligase LigD ligase module;ATP-dependent DNA ligase LigD phosphoesterase module; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MTLTNLDKVIYPETGTTKADVLAYYAAVGHVLIPAAANRPATRKRWVNGVGTADKPGEVF
FQKNLEDSAPGWLPRAAITHKDRTIYYPMVNDPATLAWFGQINSLEIHVPQWQVDSHGNQ
LNPDRLVLDLDPGEGAGIEECVEVALLARSILEDVGLDPVPVTSGSKGIHLYAALDRSQT
SDQISAFARELARALESDHPDLAVSDMKKTLRKGKVLVDWSQNNAAKTTIVPYSLRGRPT
PMVAAPRTWEEIGSPGLTHLDYHEVMRRVREGIDPFAAVVRASGHSADDVAAHREDSHDG
NPRLAKYRSMRDPQATPEPFSGAAGSGDAFVIQEHHASRLHFDLRLEHEGVLVSWALPKG
VPESSGKNHLAVQTEDHPMDYLTFQGTIPKGEYGAGEMTIWDHGTYDLHKWINGKEVIVT
LKGSEGGGLGGTRKFALIHTGRGQGKESEGQWLIHLMDPEHRGGRRRHASPRGEQEEAGQ
PEAAGEPLQDEAPKNPVTTKTAPAKTATTADDSSAVAAAGAAPSPEDYRPMMATSGDAAD
LQGSNWQFELKWDGVRAIVLGDGGAVRIFSRNGIDVSRTYPEFTDRSCWPERPFVADGEI
VAVGPAGRPDFGLLQGRMKLTRPADVERARKAIPVQLMLFDLLHDDGTDLRRLPLAKRRQ
RLEDFFTPAGCPAQLSPVLEEQVEDILDSARELGLEGVMAKRTDSRYVSGQRTRTWIKLK
VEQTQEVVVGGWRPGKGGREDTVGSLLVGIPDGKKLQYAGRVGSGFSGRELAELRQTVDR
LARKTSPFLDVPRPDAADAHWVAPELVGEVTYSEWTGTGRLRHPVWRGWRLDKDPAEVVR
EG

BLAST