GenomeNet

>apo:Arcpr_1256 hypothetical protein; K01622 fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11] (A)
MSEKITVSVIKADIGSVAGHSTVPDEIKALAEKKLNEAKEKGIIIDFRVFNAGDDLELVM
THRKGVDSEEIHGLAWETFKACAEKAKELKLYAAGQDLLKEAFSGNVRGLGPGVAEMEFT
ERPAEPIIVFMMDKTEPGAFNLPIFRMFADPFNTAGLVIDPSMHQGFRFEVWDIKEHKRV
MLSTPEEMYDLLALIGSKGRYVIKRVYPKEGGKLPADEPVAVVSTEKLFEIAGEYVGKDD
PVAIVRAQSGLPAVGEVLEAFAFPHLVSGWMRGSHNGPLMPVPFRYSKCTRFDGPPRVIA
AGFQLCNGKLIGPVDMFDDPAFDYTRQKAMEICDYIRRHGPFEPHRLPHEEMEYTTLPKV
LKKLEARFEKI

BLAST