GenomeNet

>aqu:100635973 creatine kinase M-type-like; K00933 creatine kinase [EC:2.7.3.2] (A)
MASSSKFTPEQDYPDLSKHNNHMAKHLTKEIYANLRDKKTPSGFTLDECIQTGVDNPGHP
FIMTVGCVAGDEESYEVFAELLDKVIDTRHNGYSKDAKHKTDLNPENLKGGDNLDPNYVL
SSRVRTGRSIRGFGLPPHCSRAERRGVENIVTDVLNSFEGEFKGKYYPLNKMTEAEQQQL
IDDHFLFDKPVSPLLLSSNMARDWPDARGIWHNDVKNFLVWVNEEDHTRVISMQKGGNMK
EVFTRFCNGLQSFEKKMKENGHEFMWNSHLGYVLTCPSNLGTGLRAGVHVKLPKLSGDSR
FKDILLKLRLQKRGTGGVDTASTDGIFDISNLDRLGSSEVDQVQVVVDGVELLIKMEKRL
EAGESIDDLIP

BLAST