GenomeNet

>aqu:100635973 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) creatine kinase M-type-like (A)
MASSSKFTPEQDYPDLSKHNNHMAKHLTKEIYANLRDKKTPSGFTLDECIQTGVDNPGHP
FIMTVGCVAGDEESYEVFAELLDKVIDTRHNGYSKDAKHKTDLNPENLKGGDNLDPNYVL
SSRVRTGRSIRGFGLPPHCSRAERRGVENIVTDVLNSFEGEFKGKYYPLNKMTEAEQQQL
IDDHFLFDKPVSPLLLSSNMARDWPDARGIWHNDVKNFLVWVNEEDHTRVISMQKGGNMK
EVFTRFCNGLQSFEKKMKENGHEFMWNSHLGYVLTCPSNLGTGLRAGVHVKLPKLSGDSR
FKDILLKLRLQKRGTGGVDTASTDGIFDISNLDRLGSSEVDQVQVVVDGVELLIKMEKRL
EAGESIDDLIP

BLAST