GenomeNet

>aqu:100639302 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase, cytosolic-like (A)
MSCVSSGFSCISGALSKGQIQVILGPMFSGKTTELMRRMRRYQVANQSCLIIKYSKDDRY
DKNGVATHDKQVSSAMAATKLYELKKTVGDYGVIGIDEGQFFPDLVEFCEDMANAGKTVI
VAALDGTFQRKAFGSVLNLIPMAESVVKLKAVCMMCFNDAAFTKRLGSEKEIEVIGGADK
YMAVCRTCYQLPSVKHSLLSTETPIRGGGPSVNGRQLFDFTDDFIN

BLAST