GenomeNet

>aqu:100642011 K01556 kynureninase [EC:3.7.1.3] | (RefSeq) uncharacterized protein LOC100642011 (A)
MSSAELPDLRTREEIHGYLKDLSSQLGLSLSDPQFAVALDSRDQLKKLREEFNIPKIGEL
LEGRAKADGLDLSAECIYLVGNSLGLQPKNAKELLSIEMDKWGKKGLYGHMDGTYDWYSI
DDFVKDENARIVGAKPIETVVMNTLSVNCHLAMVSFYSPTPQRYKILMEKDAFPSDHFVV
ESQLNFHGYDPKEAAIYIKPREGESIWRNEDILNVIEEHGESIALIWLPGIHFSTGHVFD
MKSITEAGHAKGCYVGFDLAHAAGNIEMSLHEWGVDVAAWCSYKYMNSGPGCLAGFFVHE
KHAYDFDRPRFVGWWAHSSDTRMDMKRKIQLAPGADGFKISNPPTLSIMGMIASMEIFKK
TSMAELCIKSRILTGYLELLIEENLSSHVTIVTSRNVSERGCQLSVKFSCPLEDITKFVK
ERGVMIDCRSPMMRIAPAPLYNSFSDIQAFYTILLQAFDT

BLAST