GenomeNet

>ara:Arad_12205 ABC transporter; K01999 branched-chain amino acid transport system substrate-binding protein (A)
MSNNKGIFETTVTRRSFLGTTTIGAAGLAFGLASPAIAQGAPLKVGIMLPFSGTYAKLGQ
FIENGFHLYVEQKSGLLGGRRVEFVRLDDESKPETATDNMNRLVGRDKVDFVVGTVHSGV
AMAMVKVARDTGCPLIIPNAGADEATGPLCAPNIFRTSFSNWQAAHPMGKVMRDEGFGKV
ATITWRYGAGQQMTKAFKEGFEAAGGTVVEELTVPFPEVEFQALITRIAELKPDAVFAFF
AGGGAVKFVVDYAAAGLKGKIPLYGTGFLTDGTLKAQGASAEGIRTTLHYADDLDNPANK
SFLEGFKAKTGDTGDIYAVQGFDAAALLDVGLAATGGDSQARDALFAAMQAAKLDSPRGP
LSFSAAHNPIQNIYLREVREGRNMLVSIAGDAVNDPARGCRMS

BLAST