GenomeNet

>ara:Arad_1370 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase protein (A)
MLTIYGVYRSRASRNYWMAEELGIEFKSVPVIQAGRIANPLATDAPLNTTSPEFLAINPM
GMIPCIKDGALVMHESLAINLYLARKYGGPLAGKTVEEEGQLLMWTMWAATEVEPYSVAL
VRIYDNGLEGSEAGKAGIAVACRSLKKPLDVLEQHLQNQDYLVGDRFTVADLNTAEVLRY
AQTEQPLFDSRPKVKAWIERCQSRTAYKTMQAGRAKEPA

BLAST