GenomeNet

>ara:Arad_1428 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodB; superoxide dismutase protein (A)
MAFELPELPYDYDALSPFMSRETLEYHHDKHHKAYVDNGNKLAAEAGLSDLSLEEIVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFAAAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNLRPKYLEA
FIDSLINWDYVLERYEAATK

BLAST