GenomeNet

>arp:NIES39_K02830 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (A)
MQTLPKERRYETLSYLPPLTDAQTQKQLQYILEQGFIAGVEFSESSAPEQHYWTLWKLPL
FNATTVREVMAEIDECRREYPKCFIRVMGFDNVKQCQVLSFIVHRPTGSLY

BLAST