GenomeNet

>arr:ARUE_c20370 ribulosebisphosphate carboxylase-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MYIPFMDGETMRDPRSVRCTYYLESEIDPAKAAAIMAGEQSSGTFMPVPGESARIRERHA
ARISDVQELGFCRPSLPSRATPEKVRAALVTVDFPMENIGTDLATLQTAIAGNLFELGDL
YACRLQDIALPEDFVAAHPGPAFGIEGTRKLISDVQGVMVGTIVKPNVGLSEEEFRLVVR
DLAMASIDLIKDDELMTDPAYLPLERRVAVATEEIRAAEQVTGHSTMYAFNITGDLAGLK
KRHDLVVDAGGRCVMLNIPVMGLPALALLRSFAEVPIHGHRAGLAASMRSKGLGMDYRVW
QQMARLAGADHLHASGLGSKFYELDEEVAANIRSLLEPLGQTTAPLPVLSSGQNVTTPGP
TFEAVGSTDLMMLAGGGVAAHPDGPGAGVRSLRQAWEAAVAGVPLQEAAQKRSHTGDDAL
LHAVQTFGKGA

BLAST