GenomeNet

>art:Arth_0294 ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD ligase module (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MAGSRERVRIQGRELVVTNLDKVMYPETGTTKADVLAYYTAVAPVLVPAAVNRPATRKRW
VNGVGTAEAPGEMFFQKNLEDSTPGWIPRASIRHKERTNQYPLVNDAATLIWLAQMGSLE
IHVPQWRVDPHGNPMNPDRLVLDLDPGEGAGLAECAEVARLARAILRDVGLDPIPVTSGS
KGVHLYAGLDGTQSSDQISEFAHELARALESDHPDLAVSDMKKTLRTGKVLVDWSQNNAA
KTTIVPYSLRGRLRPTVAAPRTWRELASPKLKQLDYREVMRRVKDGKDPFAPVSAGGSHV
RGHPGGGGSAAGPRDSTTADGGSTDPRLEKYRSMRDPEGTPEPFSADRHGADPNAGTIRE
RFVIQEHHASRLHYDFRLERDGVLVSWALPKGVPTSGTQNHLAVQTEDHPMDYLDFEGTI
PKGQYGAGNVTIWDHGYYECDKWIAGKEVIATLTGADGGGLGGTRKFALIRTSRDSDTSK
SPEQAQWLIHLMDRKGHAPAATGTPPATGGPAEAAKQDEPPPDLSPAPDFLPMMASAGTP
ADLRGLDWQFELKWDGIRALIIGDADRIRLISRNGNDMTASYPELTDRSCWPEQSFTADG
EIVAVGPSGRPDFGLLQTRMKLTKAADVAKARAATPVRLMVFDLLSDAGEDLRRMPLRRR
RARLEQLDWPDGCPVHLSEVLDHEVEHILESARELGLEGIMAKRLDGRYVSGERSRSWLK
LKFERTQEVVVGGWRPGKGSRQGSVGSLLVGIPDGAKLRYVGRVGSGFSDRELKELRLQV
DTLSRKTSPFTEVPAADASDAHWVAPGLVGEVTFGEWTGGGKLRHPVWRGWRLDKNADDV
VAESG

BLAST