GenomeNet

>asa:ASA_2319 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) glpB; anaerobic glycerol-3-phosphate dehydrogenase subunit B (A)
MKFDSIVIGGGMAGLSAALRLAEAGQKTLLMASGQSALHFSSGSIDLLESEGDPRAALPA
FMAEHPDHPYSKVGLTNIEASLADLQRHCHEQGLPLFRQETNHQRLTPIGTLKSTWLSPH
TCACQTDAPAPDAILLATLEGFRDFHPALAAANLATHPRFAHCRIMTGEIRLPQLAEFSR
NPHEFRSADIARLFDKQKGDQPDLLADLAREICRMVHESSDPGCRHVVLPACLSLGLVGP
RLAELEKRTGCTIKEVATMPPSLIGMRMQEALKRRFQALGGTFLTSERVLGARYEGDKVL
GVHSQNGDDQLFEADHFVLASGSFFSRGLESRLRGIREPIFNADVLSLEERDAWAGRRLF
DHHPFMGFGVKTDDKLRVMRGGKPLTNLYGAGSVLAHYDPIKEGSGSGVAVATGWQAAGH
ILGAAQ

BLAST