GenomeNet

>asd:AS9A_4216 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MELEVGDRVIKLSSPDRVYFTQRGETKLDLAKYYMSVGDGIVRALRERPCMLHRFPDGVD
GQKVHQKRLPRGAPPWVETVRLHFPRYNRTADELCVTELGSVIWAVQMSTVEFHPWNSRR
ADTEKPDEWRIDLDPMPKCPFSKVRRAAEVSHEILEELGAVGWPKTSGGHGLHIYVRIKP
EHGFAEVRRAALAFAREVERRLPDDVTTAWWRRDRSPSDLFVDYNQNARDHTIAAAYSVR
GNPRGTVSAPLKWDEIPDAEPNDFTIASMPDRFAKFGDLHEGIDDAVFDLQPLLEWADRD
GLEQ

BLAST