GenomeNet

>asd:AS9A_4216 DNA polymerase LigD, polymerase domain-containing protein (A)
MELEVGDRVIKLSSPDRVYFTQRGETKLDLAKYYMSVGDGIVRALRERPCMLHRFPDGVD
GQKVHQKRLPRGAPPWVETVRLHFPRYNRTADELCVTELGSVIWAVQMSTVEFHPWNSRR
ADTEKPDEWRIDLDPMPKCPFSKVRRAAEVSHEILEELGAVGWPKTSGGHGLHIYVRIKP
EHGFAEVRRAALAFAREVERRLPDDVTTAWWRRDRSPSDLFVDYNQNARDHTIAAAYSVR
GNPRGTVSAPLKWDEIPDAEPNDFTIASMPDRFAKFGDLHEGIDDAVFDLQPLLEWADRD
GLEQ

BLAST