GenomeNet

>asm:MOUSESFB_0199 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alr; alanine racemase family protein (A)
MENLYLEVNLYNIDKNIGIIRNILGNKKFIAVVKGDAYGLGIHKICDFIKEKVDLFGVSD
IDEAITLYNIGIENEILILTPIIMKEYFKNPLIEKFTVTIDNREILDFIPKELNINAHIY
VCTGMNRKGIKIEELNEFIRYVENNYNNINITGIYTHLHNAKDEKYTLNQIDMFKNAVLK
YKGKYLIHVLNSKGFINKNIRERADFCDGIRIGNLIYGYDGSSLGISKSFNYYSKVISSY
MVKKGEYVGYGNKVKLKDDTNVCILGIGNIHHIGFYREFKRNFIYDLLKFVYRYFVKPCE
IYKGNTRVKILGSSNMNLTLVDGEGLEIGDYLKVCISPILGDSSIHKKYIIKE

BLAST