GenomeNet

>asn:102387884 K05620 transglutaminase 3 [EC:2.3.2.13] | (RefSeq) TGM3; protein-glutamine gamma-glutamyltransferase E (A)
MGQALTLREVNWQRSENGSAHHTGKYPGKELVVRRGQAFTITLTFSGEWKTGQGLTFVAE
TGPRPSLQAKTQAVFDISKPASKDTWGAGLQSTSSGSARISISSPATAPIGRYRLSVRVT
LAGRSSTLNIGTFVLLFNPWSKEDEVFMPNAAECNEYVLEEFGVIFVGSSFYMHSFGWNY
GQFQGDILDICLSILDRSLEYRRDAATDVSRRNDPKYVGRVLSAMVNSLDDSGVLMGNWS
GDYSGGKSPNSWSGSVAILVNWKQSGYKPVKYGQCWVFAAVLATVLRCLGIPSRAISNFN
SAHDADENLTVDEYYDAAGNPLNTGVDSVWNFHVWNEGWFTRSDLGPSYGGWQVLDATPQ
EKSEGIFQCGPASVTAIKEGDVDLRHDVPFVFAEVNADRIAWTYDSATRKKKPLHTDTKS
IGQSISTKAVGSYDRVDVTNEYKYEEGSQKERIIFKKAHEKMVPDAELRGTSARLLEIIP
KPHISGKFKVDSPLEVGKDVNLILILSNLTSVARNVKANITAWAIVYTRKPIREIWKDTL
SVTLAANEEKQLPIKITYAEYQQRLTTDNMIQITALCQVQSGTEVLVQRELTMTNPPVDM
KVLGEAKVNKAVEVEVMFTNPINEEVKDCMLRAEGNDLLNGSLKINVPSLKPNETSAVQF
EIIPTKSGTKQLLINFSCDKFSDIKAFETINVAK

BLAST