GenomeNet

>ath:AT1G17770 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SUVH7; histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3-like protein (A)
MDKSIPIKAIPVACVRPDLVDDVTKNTSTIPTMVSPVLTNMPSATSPLLMVPPLRTIWPS
NKEWYDGDAGPSSTGPIKREASDNTNDTAHNTFAPPPEMVIPLITIRPSDDSSNYSCDAG
AGPSTGPVKRGRGRPKGSKNSTPTEPKKPKVYDPNSLKVTSRGNFDSEITEAETETGNQE
IVDSVMMRFDAVRRRLCQINHPEDILTTASGNCTKMGVKTNTRRRIGAVPGIHVGDIFYY
WGEMCLVGLHKSNYGGIDFFTAAESAVEGHAAMCVVTAGQYDGETEGLDTLIYSGQGGTD
VYGNARDQEMKGGNLALEASVSKGNDVRVVRGVIHPHENNQKIYIYDGMYLVSKFWTVTG
KSGFKEFRFKLVRKPNQPPAYAIWKTVENLRNHDLIDSRQGFILEDLSFGAELLRVPLVN
EVDEDDKTIPEDFDYIPSQCHSGMMTHEFHFDRQSLGCQNCRHQPCMHQNCTCVQRNGDL
LPYHNNILVCRKPLIYECGGSCPCPDHCPTRLVQTGLKLHLEVFKTRNCGWGLRSWDPIR
AGTFICEFAGLRKTKEEVEEDDDYLFDTSKIYQRFRWNYEPELLLEDSWEQVSEFINLPT
QVLISAKEKGNVGRFMNHSCSPNVFWQPIEYENRGDVYLLIGLFAMKHIPPMTELTYDYG
VSCVERSEEDEVLLYKGKKTCLCGSVKCRGSFT

BLAST