GenomeNet

>ath:AT3G62760 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) ATGSTF13; Glutathione S-transferase family protein (A)
MAMKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDD
DLTLFESRAITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLI
VVPLQGESPNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKT
IHAGLINDRPNVKAWWEDLCSRPAFLKVSPGLTVAPTTN

BLAST