GenomeNet

>ath:AT4G25000 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) AMY1; alpha-amylase-like protein (A)
MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGIT
HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTA
ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRV
QKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDGK
LDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGIM
PGNAVTFIDNHDTFRTWVFPSDKVLLGYVYILTHPGTPCIFYNHYIEWGLKESISKLVAI
RNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSNFALAYSGLDFAVW
EKK

BLAST