GenomeNet

>ath:AT4G36450 K20537 mitogen-activated protein kinase 7/14 [EC:2.7.11.24] | (RefSeq) MPK14; mitogen-activated protein kinase 14 (A)
MAMLVDPPNGIRQEGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINSETNERVAI
KKIHNVFENRIDALRTLRELKLLRHVRHENVISLKDVMLPTHRYSFRDVYLVYELMDSDL
NQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTYEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQL
KLIINVVGSQQDWDLQFIDNQKARRFIKSLPFSKGTHFSHIYPHANPLAIDLLQRMLVFD
PTKRISVSDALLHPYMEGLLEPECNPSENVPVSSLEIDENMEGDMIREMMWEEMLHYLPR
A

BLAST