GenomeNet

>ath:AT4G36450 MPK14; mitogen-activated protein kinase 14; K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MAMLVDPPNGIRQEGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINSETNERVAI
KKIHNVFENRIDALRTLRELKLLRHVRHENVISLKDVMLPTHRYSFRDVYLVYELMDSDL
NQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTYEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQL
KLIINVVGSQQDWDLQFIDNQKARRFIKSLPFSKGTHFSHIYPHANPLAIDLLQRMLVFD
PTKRISVSDALLHPYMEGLLEPECNPSENVPVSSLEIDENMEGDMIREMMWEEMLHYLPR
A

BLAST