GenomeNet

>ath:AT5G38410 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) RBCS3B; Ribulose bisphosphate carboxylase (small chain) family protein (A)
MASSMLSSAAVVTSPAQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWP
PIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTE
A

BLAST