GenomeNet

>ath:AT5G40610 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) GPDHp; NAD-dependent glycerol-3-phosphate dehydrogenase family protein (A)
MRFRSFFFSSSIFSLSHSRSPSLSSSRFSSLSAAMSPALEKSRQGNGGCNDDSKSKVTVV
GSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEEVLPNGEKLNDVINKTNENVKYLPGIK
LGRNVVADPDLENAVKDANMLVFVTPHQFMDGICKKLDGKITGDVEAISLVKGMEVKKEG
PCMISSLISKQLGINCCVLMGANIANEIAVEKFSEATVGYRGSREIADTWVQLFSTPYFM
VTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGNNTKAAIMRIGLREMKALSKLLFPSVK
DSTFFESCGVADVITTCLGGRNRRVAEAFAKSRGKRSFDELEAEMLQGQKLQGVSTAREV
YEVLKHCGWLEMFPLFSTVHQICTGRLQPEAIVQYRENKL

BLAST