GenomeNet

>ath:AT5G66760 SDH1-1; succinate dehydrogenase [ubiquinone] flavoprotein subunit 1; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MWRCVSRGFRAPASKTSSLFDGVSGSRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRSSQ
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDA
VIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGE
KTIAWLDRLRNSNGSLPTSTIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQ
VKDRSMIWNSDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTL
GYWEDEKVRLDYRPVHMDTLDDEIDTFPPKARVY

BLAST