GenomeNet

>ath:AT5G66760 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) SDH1-1; succinate dehydrogenase 1-1 (A)
MWRCVSRGFRAPASKTSSLFDGVSGSRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRSSQ
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDA
VIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGE
KTIAWLDRLRNSNGSLPTSTIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQ
VKDRSMIWNSDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTL
GYWEDEKVRLDYRPVHMDTLDDEIDTFPPKARVY

BLAST