GenomeNet

>atu:Atu2636 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) sucA; 2-oxoglutarate dehydrogenase subunit E1 (A)
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPSSVSPEWQSFFKALSDNPEDVKKAA
KGASWKRANWPIPANGELVSALDGNWATVEKAIEKKVQAKAEAKSADTGKPVSEAEVLQA
TRDSVRAIMMIRAYRMRGHLHAKLDPLGIASAVEDYNELSPKSYGFEESDYDRKIFIDNV
LGLEYATVREMVEILERTYCSTLGVEFMHMSNPEEKGWIQERIEGPDKGVDFTPEGKKAI
LSKLVEAEGYEQFLDVRFKGTKRFGLDGGESLIPALEQIIKRGGQDGLEEVVLGMAHRGR
LNVLTNVMGKPHRAVFHEFKGGSFKPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANP
SHLEIVNPVVMGKARAKQDQLAKTWDGDIIPLSERAKVLPLLLHGDAAFAGQGVVAEILG
LSGLRGHRVAGTMHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVY
AAKVATEYRMKFHKPVVIDMFCYRRFGHNEGDEPAFTQPKMYKVIRGHKTVARIYADRLI
AEGLITEGDFEKVKADWRAHLEQEFEAGQSYKPNKADWLDGQWSGLRAADNADEQRRGKT
GVPMKQLKEIGKKLSTIPEGFTAHRTIQRFMENRSQMIETGEGIDWAMAEALAFGSLVVD
GHKIRLSGQDCERGTFSQRHSVLYDQETEERYIPLANLAPTQARYEVINSMLSEEAVLGF
EYGYSLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGP
EHSSARLERWLQMCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLILMTPKSLLRHKRA
TSSLAELAGESSFHRLLWDDAEVIKDGPIKLQKDAKIRRVVMCTGKVYYDLLEEREKRGI
DDVYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGSWSFIDPYLEWVLAHIDA
KYQKVRYTGRPAAASPATGLMSKHLAQLAAFLEDALGE

BLAST