GenomeNet

>ava:Ava_2483 glutathione S-transferase-like protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLKFYYNHRSPMARRVWRTLLEKEITFEPILMSLDGDQLQPEFVEINPFHHIPVILDDGF
RVIESLAIMDYLESKYPTPALLPKESESLAKVRMVQMVATNELLPKMISLIFEEKNSAKF
LQAYEHINKVLGFLSESLDNESYYGGEQLTLADIVAGTDLSLLPKLGISFSNYPNLQDWF
ERLMTRKSWQQTELSVEDFEKFKRVFIKLRQR

BLAST