GenomeNet

>ave:Arcve_1477 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) Y414 protein (A)
MKFVAQALGLSEPAARKLEDRNILREAVIKHPFFADIIEAYNLEKKFGAYEEGTLIAKTN
NSLEVIRGYPKIRRALVLYPTLKKHFKGEVAIEEKMNGYNVRIVKMGSNLYAVTRRGFIC
PYTTEKARLVFEMDFFRDNPHLMLCCEAVGDESPFVPKDIYGSGVHFYVFDIRVKKTNEP
LGVREKEKVAEEYGFRLAPILEFADVKRAHEAVIEAVEKLGRQGREGVVIKDVSMKRPPV
KYTTSQSNCSDLSYAFRYFNEYARDFMISRIVREAFQSFEFKESEEEFRQRCLRLGESIL
RPMVESIRDVKEKGRVAEKSKLRFYNLEVFELFKEHLRRMGVDARFSEPAEDNGSYIVFM
ERYMMSTTDKISNLLKGGFW

BLAST