GenomeNet

>ave:Arcve_1477 Y414 protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MKFVAQALGLSEPAARKLEDRNILREAVIKHPFFADIIEAYNLEKKFGAYEEGTLIAKTN
NSLEVIRGYPKIRRALVLYPTLKKHFKGEVAIEEKMNGYNVRIVKMGSNLYAVTRRGFIC
PYTTEKARLVFEMDFFRDNPHLMLCCEAVGDESPFVPKDIYGSGVHFYVFDIRVKKTNEP
LGVREKEKVAEEYGFRLAPILEFADVKRAHEAVIEAVEKLGRQGREGVVIKDVSMKRPPV
KYTTSQSNCSDLSYAFRYFNEYARDFMISRIVREAFQSFEFKESEEEFRQRCLRLGESIL
RPMVESIRDVKEKGRVAEKSKLRFYNLEVFELFKEHLRRMGVDARFSEPAEDNGSYIVFM
ERYMMSTTDKISNLLKGGFW

BLAST