GenomeNet

>avi:Avi_3412 K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] | (GenBank) PEP phosphonomutase protein (A)
MNIATNSLYVDNLTRGTALRGLIHRSELTFLMEAHSGLSAKIVEEAGFDGIWASGLSISA
MLGLRDNNEASWTQVLDVLEYMADSASIPILVDGDTGYGNFNNARRFVRKLCDRGLAGVC
FEDKLFPKTNSFIGEAQPLAEIGEFSGRIKAALDARNDDGFCVIARVEALIAGHGMMEAM
RRAEAYHQAGADAILIHSKKDDAGEIVEFSRLWANRCPLVIVPTKYYRTPTQTFKDAGIS
TVIWANHLIRSSITAMADTARKIQAEQCLVNVEGGIATVDEIFRLTKQDELSAAESKYLP
PMTGLVPCIGCSGQLTGQEMPCSSNCKL

BLAST