GenomeNet

>avi:Avi_5106 oxidoreductase; K11178 xanthine dehydrogenase YagS FAD-binding subunit [EC:1.17.1.4] (A)
MKAFTFERAPSIEAAVKTAAANPDARFIAGGTNLLDLMKLEIETPTHIIDVNGLGLDEIE
STDDGGLRIGALVRNTDLAAHMTVRRDYGLLSRALVAGASGQLRNKATTAGNLLQRTRCP
YFYDPNQPCNKRQPGSGCSAIGGFSRQHAVVGVSDACIATHPSDMAIAMRALDATIETVK
ADGSRRSIPIADFHRLPGETPHIESVLERGEFVTAVLLPPPIGGKHIYRKVRDRASYAFA
LISVGAVIQADGTGRVAVGGVAHKPWRIEAAEAELPRGARDAAKAILADARPTEQNRFKV
DLVERTLGAVLSEARG

BLAST