GenomeNet

>avi:Avi_7569 hypothetical protein; K00886 polyphosphate glucokinase [EC:2.7.1.63] (A)
MDEKPQIVLAVDVGGSHVKIMNSVDGVESKAVSGPEMDAAAMAEAVETLASGMDYDVIAI
GYPGPVVHNRILTEPHNLAAGWTGFDFAKRFGKPVRIVNDALMQAMGSYDGGRMLFLGLG
TGLGAAMIVNYVTQPMELAHLPYRKGRSYEDYLGQASLKERGHRKWEKHVLRAVEQLSAA
LEPDYVVIGGGNVTKLKTLPTNARHGDNANAFKGGFALWLDSRFQT

BLAST