GenomeNet

>avi:Avi_7569 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) conserved hypothetical protein (A)
MDEKPQIVLAVDVGGSHVKIMNSVDGVESKAVSGPEMDAAAMAEAVETLASGMDYDVIAI
GYPGPVVHNRILTEPHNLAAGWTGFDFAKRFGKPVRIVNDALMQAMGSYDGGRMLFLGLG
TGLGAAMIVNYVTQPMELAHLPYRKGRSYEDYLGQASLKERGHRKWEKHVLRAVEQLSAA
LEPDYVVIGGGNVTKLKTLPTNARHGDNANAFKGGFALWLDSRFQT

BLAST