GenomeNet

>avn:Avin_13190 K03587 cell division protein FtsI (penicillin-binding protein 3) | (GenBank) ftsI; Penicilin-binding Protein 3 (A)
MMKLEGALYPWRFRLVLILLALMVATIAWRIVDLHIFDHDFLKGQGDARSMRHIPIPAHR
GLITDRNGEPLAVSTPVTTLWANPKELAGARDQWATLAKALGQDEKALTERLEQLAGREF
AYLVRGLTPEQGQAVLDLKIPGVYALEEFRRFYPAGEVTAHVLGFTDIDDHGREGMELAF
DEWLAGVPGKRQVLKDRRGRLIRDVQVVQNAKAGKTLALSIDLRLQYLAHRELRNAITEV
GAKAGTLVMIDVKTGEVLAMVNQPTYNPNNKRNLNPAAMRNRALVDVFEPGSTMKPLSMS
AALETGRWKPSDRVEVAPGRLQIGRYTIRDVSHAEGGVLDLTGILIKSSNVGMSKVAFDI
GGASIHSLMQRVGFGQDTGLSFPGEQVGNLPSHREWRKAETATLSYGYGLSVTAVQLAHA
YATLANDGRSLPLALARQEQAPEGVQVISPNVAKTMQGMLQQVVEAPGGVFRAKVPGYHV
AGKSGTARKASVGAKGYKEKSYRSLFAGFAPTSAPRIAMAVVIDEPSNGAYFGGLVSAPV
FGRVMAGALRLMNVAPDNLPPPAETKTVNKDASGKGERI

BLAST