GenomeNet

>avn:Avin_13190 ftsI; Penicilin-binding Protein 3; K03587 cell division protein FtsI (penicillin-binding protein 3) (A)
MMKLEGALYPWRFRLVLILLALMVATIAWRIVDLHIFDHDFLKGQGDARSMRHIPIPAHR
GLITDRNGEPLAVSTPVTTLWANPKELAGARDQWATLAKALGQDEKALTERLEQLAGREF
AYLVRGLTPEQGQAVLDLKIPGVYALEEFRRFYPAGEVTAHVLGFTDIDDHGREGMELAF
DEWLAGVPGKRQVLKDRRGRLIRDVQVVQNAKAGKTLALSIDLRLQYLAHRELRNAITEV
GAKAGTLVMIDVKTGEVLAMVNQPTYNPNNKRNLNPAAMRNRALVDVFEPGSTMKPLSMS
AALETGRWKPSDRVEVAPGRLQIGRYTIRDVSHAEGGVLDLTGILIKSSNVGMSKVAFDI
GGASIHSLMQRVGFGQDTGLSFPGEQVGNLPSHREWRKAETATLSYGYGLSVTAVQLAHA
YATLANDGRSLPLALARQEQAPEGVQVISPNVAKTMQGMLQQVVEAPGGVFRAKVPGYHV
AGKSGTARKASVGAKGYKEKSYRSLFAGFAPTSAPRIAMAVVIDEPSNGAYFGGLVSAPV
FGRVMAGALRLMNVAPDNLPPPAETKTVNKDASGKGERI

BLAST