GenomeNet

>avn:Avin_28000 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) treS; trehalose synthase, maltokinase fusion protein (A)
MDQSLKSVAFLEDPFWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHPDYGSLADVRRLIAEAHRRGLRLITELVINHTSDQHP
WFQRARQARKGSAARNFYVWSDSDDKYRDTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLGIMRYWLDLGVDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
ELDARYPDRMLLAEANQWPEDTQLYFGGAPEGKGDECHMAFHFPLMPRMYMAIAQEDRFP
MTDILRQTPDIPSDCQWAIFLRNHDELTLEMVTDRERDYLWNFYAADRRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSTDRNGG
FSRADPAGLVLPPIMDPLYGFQSVNVEAQQRDSYSLLNWTRRMLAVRKQQKAFGRGSLRL
LAPANRRIFAYLREYHGADGSSETILCVANVSRSAQAVELELPQFADMVPVEMTGGSAFP
PIGQLPYLLTLPPYGFCWFLLAPASQMPSWHIKPTEGMPEFQTLVLRRLDDLLVDPNRRI
LEKEVLPAYLPKRRWFAGKGAPSGNVHIAYTVTFGNLPRPVLLSEIEVGGEGGPQRYQLP
LGFLPEEEFGSALPQQLAMTRVRRGRRVGLLTDAFTLEGFVRATVQALRERRVLAFEQGE
LRFLPTAQLDKVELPADAEVRYISAEQSNSSAVLGNALVLKLIRRVSVGVHPELEMGLHL
TGYGFANIASVLGEVCRVDAQGGCTVLMILQRYLENQGDAWEWTQNTLDRAIRDELAGGE
STLESQYSALHELESFSRQLGQRLGEMHMALAAPTEDPDFARETAGPEQAAQWTESIGAQ
LGRALEILAQRQATLAEEERAAVEQLLLQRDALLEKVGELAGACVGSLRIRVHGDLHLGQ
VLVVQGDAYLIDFEGEPSRPLAARRAKHSPYKDVSGVLRSIGYAADMAMRNAQSVDSSEA
ADQARRRIASLYQANARQAFLAAYRQAAAEIGHAWAVPDGEEAALALFSLEKTAYEIAYE
AENRPAWLAVPLRGLANLAQQLLDGEAQ

BLAST