GenomeNet

>avr:B565_2297 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MASLHYKFATMNSGKSTQLIQAHFNYLERGMHPLAMTPAIDDRFGVGVISARVGLELKVD
VFSDSCDLFEMVKARHAKKHIDVFIVDEAQFLTREQVYQLARIVDEQDIPVMAYGLKTDF
RGELFPGSYHLLCLADKFEELKSICWCGNKAHMNSRVNEAGQVMRDGEQVEIGGNDRYVS
LCRKHYLEGRAYK

BLAST