GenomeNet

>axy:AXYL_01616 AMP-binding protein; K01895 acetyl-CoA synthetase [EC:6.2.1.1] (A)
MNDQYQALYQTFRWLVPTQFNIAEACCHRWASSSPDARRIAIYYEDESGNREVWTYARLA
EAANQLANGLVKMGVGRGDRVGVVLGQRPETVVAHMAIYSVGAVVLPLSALFGPEALESR
LRDSETRVAIVDYASSANLLAVSDNCPNLQQIIGIGFADERVLPWRSLLARQPSEFKMVQ
TRSSDPAILLYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPKPADVFWSPADWAWTG
GMMDALLPTLYFGHPIVGTRGRFSVERAFELLERYQVTNTFLFPTALKMMMKAVPEPRNH
YQLALRSIMSAGESVGETVFEWCQSALGVTPNEMFGQTEMNYVVGNSQKRWPAKPGSMGR
PYPGHNVAVLDEDGKPVAPGATGEIAVNRLDIHGYPDPVMFLGYWRNEAATQAKFKGDWC
LTGDLATVDADGYLWYAGRADDVFKSAGYRIGPGEIESCLIGHPAVANAAVVPKPDAERG
ALVKAYVVLTPEFAQRDRNDIIENLQEHVRERLAPYEYPKEIEFVDELPMTTTGKIQRRI
LRLREEERSRATAGMADAQPTHAPQTETQQAPKA

BLAST