GenomeNet

>axy:AXYL_02611 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) aldehyde dehydrogenase family protein 1 (EC:1.2.1.-) (A)
MGQKLSIQLTSYEPLPYLGSKPERDSRATPISRNRPSGRYFTPHIVTQKNFIANQWVEAA
TGATIPVLNPSDGAPFEAIARSTAEDVDRAVTAAREAFEGEWGQMAPAARSRLLMRIAFA
LLERQEELAQLESADTGKPIKQARADAAAVARYFEFYAGAVDKLHGETIPYTPGFTVLTV
REAHGVTGHIVPWNYPLQIFGRSVGAALAAGNACVVKPAEDACLSLLKLAEIAAEVGLPA
GALNICTGYGHEAGAALSAHPGIDHISFTGSPQTGKMVAHAAAENHVPVTLELGGKSPQI
VFDDADLDAAMPVLLAAIIQNAGQTCSAGSRVLIQRGVYETVLKRLSDAFSATVTGPAAA
DLDVGPLINARQQDRVRGFLAEAEAEGMKVAARGQLKEGTPEAGFYQPPVLFRDVPPNSR
LAQEEVFGPVLAAMVFDTEEEALAIANGTLYGLVAGVWTRDGGRQLRLARKLRAGQVFIN
NYGAGGGVELPFGGSRQSGYGREKGFEALYGFTTLKTIAIRH

BLAST