GenomeNet

>axy:AXYL_03869 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase large chain, catalytic domain protein (A)
MNSQSFTATYLIETPLDPAKVAEVMAGEQSCGTFTRVQGETDELRARARARIESIETLES
AAAPSLPNAWLARQPGGMPGLYRRARVRIAFPVANVGASLPTLAATVGGNLYDLGEVTGL
RLESMELPANYRAQFDVPRVGIAGTRQLTGVAHGPLVGTIIKPNVGLSPEQTAHLAAQLC
AAGVDFIKDDEVCANPAHAPLAQRVAAVMAVVRAHRERTGRQVMVAFNISDETDAMRRHA
DLIEREGGTCVMASLNHCGYSAIQTLRRSTPLALHGHRNGYGALSRHPLLGLGFQAYQTL
WRLAGVDHMHVHGLQGKFSQEDAEVVESARDCLASLTLGIDDPVMPAFSSGQWAGTVPAT
WAAVRSDDLLFMSGGGILAHPDGPAAGVLSIRQAWQAMRDGERLEDYARNAPELRRAIEC
FGHRA

BLAST