GenomeNet

>axy:AXYL_06370 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase, N-terminal domain protein 7 (A)
MYTLIIGNKNYSSWSLRPWIALRATGIAFTEQKLGFFTEEFSRRVSAVSPAGLVPVLLDG
DFAVWDSLAICEYLAERHPEAHLWPQDPKARARARSLAAQMHSGFGAMRQALPMNVEARL
PGIDLPEAARQDISRLQAIWHDTRAEFGQGGAFLFGAFSIADAFFAPVVSRFNTYGIAAA
GPVRDYMDAVLALPAMQEWTRDALAEATFVPEDEPYRKHR

BLAST