GenomeNet

>ayw:AYWB_456 K02358 elongation factor Tu | (GenBank) tufB; protein translation elongation factor Tu (A)
MANEKFIRNKTHLNVGTIGHVDHGKTTLTAAITQVLSARGLAKSRAYDQIDNAPEERERG
ITIKTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDAAILVVSGADSVMPQTREHI
LLARQVGVPKIVVFLNKCDLSPDEQILELVEMEVRELLSQYDFPGDDIPVIRGSALKALE
GDAHYVAQVNKLIETLDTYIEDPVREVDKPFLMPVEDVFTITGRGTVVTGRVERGQVKAG
DEVEIVGLKETRKTIVTAVEMFKKDLEFAQAGDNVGALLRGINREDVQRGQVLAKPGSVK
PHSKFIAQVYVLTKEEGGRHTAFFSQYRPQFYFRTTDITGVVELQGDVKMVMPGDNAELV
VTLNNPIAIEEGTKFSIREGGKTVGAGSVSKLLN

BLAST