GenomeNet

>aza:AZKH_p0230 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS_rbcS; ribulose bisphosphate carboxylase, small subunit (A)
MRITQGAFSFLPDLTDAQISKQVEYCLAQGWAVSIEYTDDPHPRNTYWSMWGNPMFDLAD
PAGVMVELAECRAAFPEYYIRINAFDSTHGWETMRMSFLVNRPAEEPGFRLVRQESEGRV
VRYTLESYAVARGPEGQRYTA

BLAST