GenomeNet

>aza:AZKH_p0231 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL_rbcL; ribulose bisphosphate carboxylase, large subunit (A)
MGALETAEAIIDPKQRYRAGVLKYAQMGYWDGDYEPKETDVLALFRITPQEGVDPIEAAA
AVAGESSTATWTVVWTDRLTACDRYRAKAYRVDPVPGQPGQYFCYVAYELDLFEEGSIAN
LTASIIGNVFSFKPIKAARLEDMRLPVAYVKTFRGPPTGIVVERERLNCFGRPLLGATTK
PKLGLSGKNYGRVVYEALLGGLDFTKDDENINSQPFMHWRDRFLYVMEGVNRASAATGEV
KGHYLNVTAGTMEEMYARAEFAKSLGSTIVMVDLIIGWTAIQSMSNWCRANDMILHMHRA
GHGTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPMTVQGYYNVCREMKNAV
DLPRGIFFEQDWASLRRVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAG
ATANRVALEAMVLARNEGRDIASEGSDILKAAARDCAPLRAALDTWGEVSFNYTSTDTSD
FVPTASVA

BLAST