GenomeNet

>azc:AZC_3131 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) conserved hypothetical protein (A)
MLTLYSTRSSGNAYKVRLLLAKLRLPFRLVEVDIFAGENRTPEFLQLNPEGRVPLLELED
GHILAESNAILFYLAEGTPFLPADPVARADTLRWMFFEQNNHEPGIAQARFWLRQVRGGR
DLRAHDIDRWMEEGYGALRVMERHLVARSFFVGESLTIADIALYAHTHVAHEGDFDLAGF
PNVRGWIDRMEAAPCHVDMDWSPEMPARLFAGDECGELSLA

BLAST