GenomeNet

>bac:BamMC406_6340 DNA ligase D; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MAGKLDPYRRKRHFGATPEPEGAHGRRTQAAAKAAARTRARGAHPLRFVIQEHHARRLHY
DFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGQIPEGHYGAGSVVVWD
EGTWTPDGGLAQAREGYRAGKLTFRLDGEKLHGGWALVRSGRQQGRQEQWLLIKERDDDA
RSMDEFDVVGERPGSVHDGAASARADAKNGSARARGSRQGRSEKPATRAARHDDRAHDGH
AGAPVDPSRIEGAVRAPLPEHVAPQLATLVDGPPTQGDWCYELKFDGYRILARISGKGAR
RHVKLMTREGRDWTAKLRAQRDALAALDVDAAWLDGEAVVLGKNGLPDFQALQNAFGGGH
SDEITLFVFDLPYLDGYDLRDAPLTARRALLEPLLADSDPTRLRFSPDLGDDVASLIASA
CDTGLEGLIGKRAESRYRAGRSPAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLLGVHE
PAADGKRRRGPGPLRYVGRVGTGFDTRMLDRLTPILRKHERDKMPFDPPPRERSRTPVHW
IEPVLVAECEFAEWTGDGIVRQAAFIALRDDKPAARIVREVPKHTETEVQMDQRETAQHE
RHKPGRTAHAGRDTGDTSDTSDTSDTSDTSDTSDGKHPARSRGSRRAEADDTGPDQLGRV
RISHPERVIDSHSGTRKIDLARYWQWVAPWLLPDLKGRPVSLVRAPGDISGELFFQKHAE
RREIPFVTQHDGLDPGHGPLLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDL
DPDPALPWSAMIDAAQLVRGLLDELGLISFCKTSGGKGLHVVVPITRHMGWDEVKDFSRA
VAQHVAGALPDRFTATMGPKHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLRWD
EVPDTTGGAQWTIDTLHERLDRLKRDPWDGYDDTRQRITAQMRARLGTS

BLAST