GenomeNet

>bad:BAD_0024 hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQILREVLGEFDENLLAKF
DEVREHALKASDERFSGILTDTNPDQDDLQKVVDIIDKTDVHEAQLLARAFTTYFHLANL
CEENYRVSVLHSRENAVDDTQAVDPVNEMTCAYHQLINEMGPARAKELLDQLEFHPVFTA
HPTEARRKAVEGKIRRISQLLEAHKLLGGSDKKENSRRLFNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTPPSAELKSLWNHQKEMSERLT
DKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCEDYIADLKTVQRSLAEANAKRS
AYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGELQPMTHEVLDT
FRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLE
DLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYSDSSKDAGPTSATLALHSAQERIAK
WAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKRNTDMTKKYADMASKLDEAAHNRFLDLLNTDGFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEQFG
DLNTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDREDLNKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALGSLRKRVDKEELTHGQKENYT
YLILCTVSGVAAGLQNTG

BLAST