GenomeNet

>bafz:BafPKo_0196 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-alanine--D-alanine ligase family protein (A)
MKKNLMLIFGGVSFEHEISCKSAYSVYLALLDLNKYNIYSAYIDKCTGIWYLLDSVSDPP
KPIDTDVLPIVSLLPGFGIFSNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCVGAG
IIGSAISSNKYFCKLLLKSFNIPIVPFIGFRQYDYSLDKEEIKRNVKEVLGYPVIVKPAV
LGSSIGINVAYSENQIESCIEEALKYDLTIVIEKFIEAREIECSIIGNEKMKIFSPGEVV
VQDFIFYDYDAKYSVIPGNSIIFNIPAHLETNQLLSIKEYAFLVYKNLELRGMARVDFFV
EKKSGTIYLNEINTIPGFTDISMFSKMCSHDGLQFKDLIDNLIDYAFQSYINRKKRINFK
D

BLAST