GenomeNet

>bai:BAA_2837 acoC; acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTILDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIRALLGTGPGGRITKVDVLKALEERVAIPEVLEESKVLPVTGMR
KAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVLA
LGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNAAQK
ARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKLKKG
SMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL

BLAST