GenomeNet

>bal:BACI_c17470 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) phosphoglycerate mutase family protein (A)
MTTIYFVRHAHSTYTKEERERPLSEKGHLDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYNVSIQIEEDLQERLLSSELIENFNDAMENVWGDWSFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFESKYDFQFWKTLHMPDVYKLTFDNYCFISAER
MQSADYQINNL

BLAST