GenomeNet

>bamb:BAPNAU_3007 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; transglutaminase (A)
MIIISGQVLRPQDIANWQTEENLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEAAR
ELHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTMGEERFNRRFRDITLYDWHYEHLPIYTETGSHFLRGDCLYFKNPDFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAVQPAYLLNQATRLDAPAL
YQIMH

BLAST